PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang01g09060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 141aa    MW: 16161.3 Da    PI: 8.9624
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang01g09060.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.94.6e-131001361148
                      HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +l ++vkq+G + W+ Ia+++  gR +kqc++rw+++l
   Vang01g09060.1 100 KLMRLVKQHGDKKWAEIAEKLE-GRVGKQCRERWNNHL 136
                      7999******************.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007173.6E-587138IPR001005SANT/Myb domain
PROSITE profilePS5129417.6492140IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-1896141IPR009057Homeodomain-like
SuperFamilySSF466892.62E-1298140IPR009057Homeodomain-like
CDDcd001671.26E-1099136No hitNo description
PfamPF002491.4E-11100136IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MMLWKLYLGA RGECVAYSDG GDFYTWIEWY YVGVEPGLCY RAVLGDLRDR VGDGEEERRV  60
SVEEAPCYGG ISPSAAGGHW RCASPPGSGG WRSRRERSRK LMRLVKQHGD KKWAEIAEKL  120
EGRVGKQCRE RWNNHLRPDI K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-12951411258B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-165AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41293158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.13e-21myb domain protein 119